McDonnell Genome Institute

Washington University

CircRNA

chr12|68302619|68302872|-|MDM1|ENST00000303145.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9659

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

ALLEIQSFSTMK

Amino Acids from 5' Exons

KESRAVSLLTSPAAGIKTVDPLPLREDSEDNIHKFAEATLPVSKIPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHN,KKVVLYPYLLQLLVKQLILCLCGKILKTISTNLLRQLFQFQKFQNTQQIPLDSCLLHHMFHPTGIPLDEFRALLEIQSFSTM,RKSCCIPTDFSSCWYKNSSSAFAGRFRQYPQICGNSSSFKNSKIPNKSPWTVAFSTTCSILLASLSTNSGLSRSRVSAQ

Amino Acids from 3' Exons

KESRAVSLLTSPAAGIKTVDPLPLREDSEDNIHKFAEATLPVSKIPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHN,KKVVLYPYLLQLLVKQLILCLCGKILKTISTNLLRQLFQFQKFQNTQQIPLDSCLLHHMFHPTGIPLDEFRALLEIQSFSTM,RKSCCIPTDFSSCWYKNSSSAFAGRFRQYPQICGNSSSFKNSKIPNKSPWTVAFSTTCSILLASLSTNSGLSRSRVSAQ