McDonnell Genome Institute

Washington University

CircRNA

chr12|68296922|68302872|-|MDM1|ENST00000303145.11

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9892

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

MKPLMMK

Amino Acids from 5' Exons

WEKQGTICSYLNMKPLMMK,GKSKDEQFAVTSTSL,GKARMNNLQLPQHEAFNDE

Amino Acids from 3' Exons

KESRAVSLLTSPAAGIKTVDPLPLREDSEDNIHKFAEATLPVSKIPKYPTNPPGQLPSPPHVPSYWHPSRRIQGSLRDPEFQHN,KKVVLYPYLLQLLVKQLILCLCGKILKTISTNLLRQLFQFQKFQNTQQIPLDSCLLHHMFHPTGIPLDEFRALLEIQSFSTM,RKSCCIPTDFSSCWYKNSSSAFAGRFRQYPQICGNSSSFKNSKIPNKSPWTVAFSTTCSILLASLSTNSGLSRSRVSAQ