McDonnell Genome Institute

Washington University

CircRNA

chr12|67292621|67297853|+|CAND1|ENST00000545606.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

SLGPLVSK

Amino Acids from 5' Exons

SWSFSESERIPSRDNCRYPLHHAFRTTSRHFKYWSNSNWRTSSSFQ,LGPLVSKVKEYQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPPASS,LVLVKKNTKRQLIPSALTCFLIKNNFETFQVLVLKQLENFLQLPV

Amino Acids from 3' Exons

VNTLRRFLWWNFAMMMMNESTVFKPLNHLE,IPEDNSFGGKILQCRIKRVLYSSLIICKK,EYLEKIIPLVVKFCNVDDDELREYCIQAFESFVR