McDonnell Genome Institute

Washington University

CircRNA

chr12|6724613|6729449|+|COPS7A|ENST00000229251.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9623

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

SPTLSAVMSAEVK

Amino Acids from 5' Exons

LWTSAQVPHTQCSDECGSEGDRAEPGAISAPSQVGQGGSAGHTHPSGAGGPWCLRVWRTAGHAQCR,SGHPEPKSPTLSAVMSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRE,LDILSPSPPHSVQVRKRQGRTRSNFCSPSRPRGQRWPHSSIRCWRPLVSTCLENCWTCPMLE

Amino Acids from 3' Exons

CIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQE,VSHMQCCWRLLPCVMCGSWKTLLRLCMLTCFVAPWTSATSGSRLTTASGGTSSARTSVPLPEPCRN,YPICSVAGGSCPACAAAGRPCDGCVCRASWLPGPAQPAARGLQHRAGHPAPGPQCHCPNPAGM