McDonnell Genome Institute

Washington University

CircRNA

chr12|66515618|66596927|-|GRIP1|ENST00000359742.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9568

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

6

Peptide

QCGQEAALLIEYDVSVMDESPYTK

Amino Acids from 5' Exons

RGHDQTRQVAQCGWNSASWNYACSHEYSTMWTRSSTADRICLSN,EGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEAALLIEYDVSVM,RARSNPVTGCSVWMEFGFLELRMLKPVFLNNVDKKQHCNMMSQW

Amino Acids from 3' Exons

MRVPTLNPPARQSRLMERWLGDRASQ,ESLHIRQPDKAAWSVGCEETEHP,ESPYTKSASQTKPPDGALAVRRQSIP