McDonnell Genome Institute

Washington University

CircRNA

chr12|64830376|64870808|+|TBC1D30|ENST00000539867.5

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9373

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

AGLVDLGR

Amino Acids from 5' Exons

VWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVK,FGPWQIIICTVPLTGTKPCASLSMKGVILMMTPWEFRS,LVDLGRSLFAQYSHLGQNHALHFQKESLHGNSDSQ

Amino Acids from 3' Exons

SQMRSRVDLITLQSVQEQSIPVEVNTMQLLTVWNAPQISMHSGSTLELKRSNSSRFIRCTSGQ,AKGAESEIHCRAESRSNQFLSKIPCSFQYDDGTHDHRYQCTEAAVLSNKEATAAGSSGVHQG,PNEEQSLRSNNIAELSPGAINSCRSEYHAAFNSMMMERMTTDINALKRQYSRIKKKQQQQVHQVYIRA