McDonnell Genome Institute

Washington University

CircRNA

chr12|64728955|64744907|-|GNS|ENST00000258145.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9963

40

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

TQMDGMSLLPILEK

Amino Acids from 5' Exons

MLVANIDLGPTILDIAGYDLNKTQMDGMSLLPIL,CWLPTLTWVLLFWTLLATTIRHRWMGCPYCPF,AGCQHLGSYYFGHCWLRPKDTDGWDVLIAHF

Amino Acids from 3' Exons

EKNSKYYNYTLSINGKARKHGENYSVDYLTDVL,KRILSIIITPCLSMGRHGSMVKTIVWTTQMF,KEFVLLHPVYQWEGTEAWKLCGLPDRCF