McDonnell Genome Institute

Washington University

CircRNA

chr12|64466900|64484499|+|TBK1|ENST00000331710.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9684

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

MGGMNHLR

Amino Acids from 5' Exons

WVEIIYERMVCTVISSQEISCVLGKMDSLCTNSQILVQLENKMMSSLFLCMAQKNI,GWNESSTREWYSAPYQARKYHACYRGRWTVCVQTHRFWCSRIRRAVCFSVWHRRIF,GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL

Amino Acids from 3' Exons

CYYISTGITNQNYFFKSRTYLRRATLSLRTWKAGTTFPNYGKPYICSKPGTSEYHRINIK,ATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEK,LLYFMNWYINKPKLFLQIKNLSTKGDASNLEGWHNISLKLLRKTLYLAGNLIPDYMKK