McDonnell Genome Institute

Washington University

CircRNA

chr12|64409961|64433603|+|XPOT|ENST00000332707.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9468

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

21

Peptide

SYFAFLQTVTGSGMSEVIANQDVYK

Amino Acids from 5' Exons

MFINSSVGSEGTPITTRKLQVQRGWMNRLYGIQMLIQTLDK,CLILLWDQRARLLQPENYKYNSEDGTGSIRAKSKCFRLTK,VYKFFCGIRGHAYYNQKTTSITARMDEQALLGLNPNADSDFRQR

Amino Acids from 3' Exons

IQVSPFLQQMFMPLLHAIFEVLLRPAEENDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQ,YRYPRFYNRCSCPCFMQFLKCCSGQQKKMTSLLLRSRCCGGVTLLSCKQSQAVGAKLQIK,TGIPVFTTDVHAPASCNFSAAPASRRKPVCCFREADVAEELLCFPANSHRQWDERSYSKS