McDonnell Genome Institute

Washington University

CircRNA

chr12|64409961|64419094|+|XPOT|ENST00000332707.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9213

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

7

Peptide

DVVHTSEMFINSSVGSEGTPITTRK

Amino Acids from 5' Exons

MFINSSVGSEGTPITTRKLQVQRGWMNRLYGIQMLIQTLDK,CLILLWDQRARLLQPENYKYNSEDGTGSIRAKSKCFRLTK,VYKFFCGIRGHAYYNQKTTSITARMDEQALLGLNPNADSDFRQR

Amino Acids from 3' Exons

MLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSE,CIPNQRRPLYEIKPPKSSPCFLLQSISLSGPSFFLTFSQWTIQGEISTCESSWLLIQSWWIVMWCIHQ,AESPTREDLYTKSRPSLRLAFCYRVSHVAQVFFHSLSSGPKSKGSRSLPANPHGYFRVGGSCGAYIR