McDonnell Genome Institute

Washington University

CircRNA

chr12|64193846|64215963|-|C12orf66|ENST00000311915.12

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

MEIADFYEK

Amino Acids from 5' Exons

ISPPNPQSFGKQFPAGSRPVSSPESPGPGLRVEVPPISGFTQCAHQTADVGPDLETAGDQETSVWRAVSEGRAASTPFPLADETQKHASCQVLLLSGSEPTNDCFRNENVDSKSPRLFWKDFQLHQKICCQCVLNFQQRFEFSGSWLSPPPFLQRGPQGCGPVSSCSVSAQRQASHALAQCHHDHDGPHISEQLGESGPLLQSSEYLLPNPPGTSLYHCHHFVKEIERLPLYFLPQGLTCPEPQSVCKSETWSQ,FHHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSFYFHEALSRQTTASEMKTLTAKANPDFFGKISSFIRKYDAANVSLIFDNRGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHWPNVIMIMTDRTSDLNSLEKVVHFYDDKVQSTYFLTRPEPHFTIVIIFESKKSERDSHFISFLNEVSLALKNPKVFASLKPGAK,FTTQSSVLWKAVSSWKLTSCVISKPRPRSQSGSSSHLWLIYTVRTPNCRRGARSLRNSGRPRNICLEGSLRRPCSLHTFSFGNSKTCFLPSLAFTFMRLADKRLLQKKRQQKLTQTFLERFPASSENMMLPMCPFLTTEVLRVFRVMVITTPIPTERPPRVWTSIQLCLCPATGQSCTGPMSSSRTAHLITAWRKWSTSMMTKFRVPTSPARNLTLPLSSFLSQRNLRETPTLFPSSMRSHLPLRTPKCLQVNLEPK

Amino Acids from 3' Exons

GASLSSAGRIPSAPSILHCIMSRRWLAVVPWVGLLLTWKNSFPTCQSSSASLFRLGWRQTSMRRCTPSAHRSSSMLKSSLAFWMPSKNTAP,GPVFLQQEGFHPHHLYFIAAEEGGDWPWCPGWDCSSRGRTPFPPVRAALLLCSGSDGDSRLLEDVHPQHTEVHQCRARWPFGCHHEKIQLQ,GQSFFSRKDSIRTIYTSLHNELKKVVTGRGALGGTAPHVEELLSHLSEQLCFFVQARMEIADFYEKMYTLSTQKFINAEELVGLLDAIMKKYSS