McDonnell Genome Institute

Washington University

CircRNA

chr12|62689698|62832279|-|PPM1H|ENST00000228705.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.905

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

TPTSTLNHSCLQLQR

Amino Acids from 5' Exons

ARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPE,PGWQLLEPGDLGTMTRCMTPTSTLNHSCLQLQ,PGNGNYWSDQGTWGPPEGALQHLHTIPVFSSR

Amino Acids from 3' Exons

GYQCREEHTQRPSQLGAHCEEEGRGRDLNPKQELIQETVLPSQWGRAAAEGEL,VINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENS,LSMPGRAHTMKTKPAVRCSLRRRQGPPQPQTGTHPRDGPPFPMGKGCSRRT