McDonnell Genome Institute

Washington University

CircRNA

chr12|62532437|62538505|+|MON2|ENST00000393629.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9721

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

EIISLEMLDK

Amino Acids from 5' Exons

LRNVGQSASNYTRLRHVCGIPLFARPCSWNHKYDRRARRANRMSNHHRRFFTNTVDRTAGFTVNIRPNGGN,LEMLDKVEPPTIPEGYAMSVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQSTSDQMDKEI,KCWTKLSLQLYLKVTPCLWHSIVCTLFVESQVLKESESLKQNVKPPLKKVLHQHSRQNSRIYSQHQTKWIRKL

Amino Acids from 3' Exons

VSCITASFNKCTLLLVSRSNGYGLWK,YLDDVSLHHLINALCSLSLEAMDMAYGNNK,ILMMYHCIIMHFAPCLKQWIWPMEII