McDonnell Genome Institute

Washington University

CircRNA

chr12|62390863|62391429|+|USP15|ENST00000280377.9

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9837

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

ILMGMAQMAYMK

Amino Acids from 5' Exons

PICQNIYNRNRIPTLLGPKYWEWPKWHTRRLT,RYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSP,DMSKYLLKLKKLKDPYTAVRTKILMGMAQMAYMKKAHQ

Amino Acids from 3' Exons

VKWKQMSQMMNPARIKNFPQRMKTVSLKIQLEEIMILKMDYVLRILAKVNSRDTKNDCLHSSSTTAILISTTSKMIPGIDLMIGSLGM,NGNRARIQPGSRTSLREKQSVRFSWRRFKWIMYGYLQRSTHGTQKTIVYIPVQQLRQYYQLHQRYQAYKIAAAR,EMETDEPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLD