McDonnell Genome Institute

Washington University

CircRNA

chr12|6052542|6057072|-|VWF|ENST00000261405.9

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9952

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

VLLLGRPR

Amino Acids from 5' Exons

STARKARCTCSAGPPATPAALSLTRMRNAMRPAWRAASAPQGSTWMRGGTACPRPSAPVTMTVRSSSQKTSSQTITPC,AELPERPGVPAVRDPLQPDLPLSLLPGGMQGLPGGLLLPPRALHGEGGLRAQGPVPLLLRDLPARRHLLRPSHHV,LNCPKGQVYLQCGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPEDIFSDHHTM

Amino Acids from 3' Exons

PGSPRRRARSRPPHSRPAIVPSARCPTCGTAATTCAPARTAASACAAPWPAMPRPARGEACASRGASQAAV,QVLRGGVRGPDVPHIRGLPSCRQPAALPAELPLRRVLLLGRPRVPVRRPGQLCRGLRGERRARRVARARPL,RFSEEACAVLTSPTFEACHRAVSPLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRC