McDonnell Genome Institute

Washington University

CircRNA

chr12|57745744|57747131|+|TSPAN31|ENST00000547992.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9293

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

13

Peptide

ILGGVGLFFSFTELVSLLLIGVAAWGK

Amino Acids from 5' Exons

LVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGL,WACCSLEWLLGARAWVWCPASTSSAESLLWESSFSLLQWLD,GELVAHWSGCLGQGPGSGVQHPHHRRSHCCGSLPSPYCSGWT

Amino Acids from 3' Exons

ICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTE,SARARAPHARCVEKSFLSIQTKPKSGVLDSSLALQ,LQEPEPHMPDVWRKVSAFRRSPENPRGCWTLLLYR