McDonnell Genome Institute

Washington University

CircRNA

chr12|57490537|57512964|+|MARS|ENST00000262027.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9907

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

RSWLPYLRR

Amino Acids from 5' Exons

EEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNP,RRSWLPYLRRRLLWLLLLGRRAKVCPRCGPSRIQ,GGAGYPIGGDCYGCYCLGEGPRKFAPAAAPAESS

Amino Acids from 3' Exons

STTMRMGNSLRAAVWECLGTWPRTRGSLLTSGASICCTFGLRARTVLSPGRTCCRIILSCLTTWATSST,VPELGWEILEPRCGSVWGHGPGHGDPCHLALLSAVHSAGPGQCFLLDGPAAEEFAAQPGQLHQQ,YLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFIN