McDonnell Genome Institute

Washington University

CircRNA

chr12|56642457|56645353|-|ATP5B|ENST00000262030.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9007

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

GSITSVQSGTMR

Amino Acids from 5' Exons

VSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQ,CLHYWAESLLLWAISLPWPLTWVLCRKELPLPRRDLSPLY,VCIIGPNPFCCGLSAYPGHHGYYAGKNYHYQEGIYHLCT

Amino Acids from 3' Exons

SGTMRRKHLLRQKQAPPPGASWRSLAQWWTSSLMRDYHQFMPWKCKAGRPDWFWRWPSIW,QGLCGANISFAKSRRRHRAHRGGHWRSGGRPVGTTTNSKCPGSARQGDQTGFGGGPAF,RDYAAQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHL