McDonnell Genome Institute

Washington University

CircRNA

chr12|56639105|56644955|-|ATP5B|ENST00000262030.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

GFQQILAGESTVR

Amino Acids from 5' Exons

DYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILA,TTNPSRISLPSWVWMNFLRKTSPCPVHGKYSVSCLSHSRLLRSSQVIWGSWYPRRPSKDSSRFWQ,LQIPPGYHCHPGYGTFGRQVDRVPCTENTAFLVSAIPGCGLHRSYGEAGTPEGDHQRIPADFG

Amino Acids from 3' Exons

VRAQGLLLWMVQKAWLEARKYWILVHQSKFLLVLRLWAESMSLENLLMKEVPSKPN,EHSKDYCYGWYRRLGRPESTGFWCTNQNSCWSDFGQNHECHWRTYKRSHQNQT,ESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTK