McDonnell Genome Institute

Washington University

CircRNA

chr12|56343824|56346624|-|STAT2|ENST00000314128.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

HLNTEPMENK

Amino Acids from 5' Exons

TGGTATTAGAARARAGVIRAGTRAGARARAQPGLRATAEGRAGSGARARVCAGVHSGACDRAHTMHGITNSARARPRTCITASARARFALSETFEHANG,QVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPME,RWMNCNNRWSLSQSQSWSHSWNGWCQSQSSAWTSHCRQGWIWGQSSLCWSPLWSLSPHYAWYHKQCQSQTKDLYHSQCQSQICPVIDITLSQWK

Amino Acids from 3' Exons

TRCSSTLCNRTRRRCCSHSRLKSSAITSCSLRRIYLKTHCASSIPESPGMKLLGATTRRK,QGAHLLCATVHEGGAAVTPADNHPPLPVAHGEYTKPTALPLSPNPPGSFWVLLPGE,KVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEK