McDonnell Genome Institute

Washington University

CircRNA

chr12|56169528|56169911|-|SMARCC2|ENST00000267064.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

3

Peptide

DIGEGNLSTAAAAALAAAAVKAKEPR

Amino Acids from 5' Exons

SILRRRRSQRKGRRKCRKWWSLRGKGRQRWSGTLARATSPPLLPPPWPPPQKL,RSEGEGAKGRAGGSAEGSGGVGGKEDKGGAGHWRGQPLHRCCRRPGRRRSES,DPEKEKEPKEGQEEVLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAK

Amino Acids from 3' Exons

EPREGGGAIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPI,NPEKEGVLRRKQKRKPARLPRRMRRKGKKATVRRSPRRVMETQ,TPRRRGCYRGGSKRENQRGSQEGGERERRRQEGVREEWRPN