top of page

McDonnell Genome Institute

Washington University

CircRNA

chr12|55703050|55707701|-|ITGA7|ENST00000553804.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9932

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

VDIDQGAR

Amino Acids from 5' Exons

AAGGCSPGPGSSWAAGESHWRPLRLPVEPGGDLLQSGHRPG,LLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQG,CWWVLPRPWLFLGSRRIALEASSLARAWRRLTATEWTSTRE

Amino Acids from 3' Exons

LAQGSSHGRGSEPRPLGGLRDLLPFWLPARRTALLTGCRLQSGRDGCLAQGGRARQPLRLLCGPAPAVAAPTPEL,SRRDRPMAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHRQLQPRPQS,RAGIVPWPGLGAATLGGPPGFATFLAPCSSNCSSHGLSPSIWTWVPCARRASQAASSASLWPCTGSCSPDPRA

bottom of page