McDonnell Genome Institute

Washington University

CircRNA

chr12|53381658|53406753|+|SP1|ENST00000327443.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

EDQDHSMDEMTAVVK

Amino Acids from 5' Exons

TKITPWMKQLWKLKKELVAIMGAMVMVVVPFHRLEVAAQAVAAALEEEG,PRSLHGNDSCGENKRSWWQWGQWWWWCLFTGSKQHRQQQHWRRRA,QDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQ

Amino Acids from 3' Exons

VIMELSLVSMGLVVMEYMMTQQVERKEKTAQMPNPKPVGGPGGKHAPAPTVKTVKE,SWSSAWSPWGWWWNTHSRWRGRRKQPRCPTPSRSEDPAGSMHLPLLRQRK,DHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEG