McDonnell Genome Institute

Washington University

CircRNA

chr12|50990794|51010766|-|SLC11A2|ENST00000262051.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

NSATQVSTMVLGPEQK

Amino Acids from 5' Exons

RLADCRRNLGPYHLFHQYVLCSGLCPGPRACGIICGGCCGQRGLSGLCVLL,GWRIAGGILVLIICSINMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYL,AGGLQEESWSLSSVPSICTLWFMSGTGMWHYMWWLLWSAWLIWALCST

Amino Acids from 3' Exons

NHILRTQPLRYPPWCWVLNRRCQM,IIFELSHSGIHHGAGSTEDVR,SYSKNSATQVSTMVLGPEQKMSD