McDonnell Genome Institute

Washington University

CircRNA

chr12|50006433|50016715|-|RACGAP1|ENST00000546723.5

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9606

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

9

Peptide

LMDTMMLNVR

Amino Acids from 5' Exons

NLSSWRRTLRISVKSGRGLTMSWGNTRIFKQRLSEVLWMLSSMHVIRWMRSNGDRELRLTAKS,IYPVGEGLGFPKVAEDPAGEIQGSFDESRDAKCSGCAEACTSGGCRDQTETESGLRKA,FIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKL

Amino Acids from 3' Exons

MDTMMLNVRNLFEQLVRRVEILSEGNEV,WILCMCGICLSSLCAGWRFSVKEMKS,GYYDAECAESVAACAPGGDSQRKS