McDonnell Genome Institute

Washington University

CircRNA

chr12|48108071|48133057|+|PFKM|ENST00000340802.10

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

SLDTMDDPDTVGSIPVFK

Amino Acids from 5' Exons

LGKLLLPACSYQSHHQRQTSRVILWMIQTPWEAYLFSKL,WGSFYFQHAHTKATTKDRHLEESRYYGSRHRGKHTCFQN,GEASTSSMLIPKPPPKTDILKSLDTMDDPDTVGSIPVFKT

Amino Acids from 3' Exons

GGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKA,EARLEVPGARTFGNEKDDSELPTTWSVGSPISVSLGVMAASLGLTPSVLSGVTCVTSRKQ,RHGDWKCPVQGLSGTRRTTPSCLQPGEAWDHQSLCHWGWQPHWGHLPFVELVEPPES