McDonnell Genome Institute

Washington University

CircRNA

chr12|47791585|47792004|-|HDAC7|ENST00000080059.11

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9521

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

LAGLIYDSVMLK

Amino Acids from 5' Exons

CLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLA,VSEAGRPPWKSCSRSTLSGTCSSTAPTRSAASNWTTGSWQ,SPRPEGLPGRAAVGPLAARAPLRHQPAQPPQTGQREAG

Amino Acids from 3' Exons

GSMTRSCSTSAPAVTTAGTRSTPAASRASGPGCRSGGSGASV,ADLLGHAEAPVLLRQQQAPGARRPHPEHLVPAAGAGAPEPV,LIYDSVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCE