McDonnell Genome Institute

Washington University

CircRNA

chr12|46367075|46371379|-|SLC38A2|ENST00000256689.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9842

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LAASGSITMQNIGGR

Amino Acids from 5' Exons

GLYYMNNWDIRHLDLESLQHLDQLQCRTLE,VFIITIGIGIWISWKACSIWINYNAEHW,SLLYEQLGYKAFGLVGKLAASGSITMQNIG

Amino Acids from 3' Exons

ADSRAAAPTAKDKRSPALLAAPDSSQCLARRPKWDDSVFPRMKTAAATVPTATSTTPTPPSKLLK,PTRGPLHPPPRTKGAQRYLHPIPPSAHEEGRNGTIQYFPGRQQQLQFQQRLQLLLPHQASCSEK,RLAGRCTHRQGQKEPSATSCTRFLPVLSMKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALK