McDonnell Genome Institute

Washington University

CircRNA

chr12|42335882|42375074|+|PPHLN1|ENST00000317560.13

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

RDEMWSEGR

Amino Acids from 5' Exons

WLTEETKCGLRDDMNMKEFRENEHLLEVIP,GLQKRRNVVGTIIKNSERTSTSSKSSQ,AYRRDEMWSEGRYEYERIPRERAPPRSHPS

Amino Acids from 3' Exons

GHERWLKKKFLLFPLCERAVSLKGQYFFQRITCWPKGFSTQQIWFQCQQKLLSRKEQIILFPSVST,DMRDGFRRKSFYSSHYARERSPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHR,TEMALEEKVSTLPIMRESGLLIKGTILFSENHLLAERILHTADLVPVSVAEATLQKGANHTLSISLNIE