McDonnell Genome Institute

Washington University

CircRNA

chr12|40980908|41029219|+|CNTN1|ENST00000347616.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9717

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

ISGPPGPPGGLR

Amino Acids from 5' Exons

ALQALQVVEKTLEPLLWHLLGAVVQTIIVLFLNTLSRPRLFFQMTGKMQRQ,PSRPSRWSENRRHSHFCGTYLEPWFRQSSYFIHYPDQDYSFRLERCKD,PPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKT

Amino Acids from 3' Exons

VLYRPDGQHDGKLYSTHKHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKIS,YSTDLMASMMASCIQLTNTPKSQSPEMENTLWRFARTVMEEMEWCLKSKFQ,TLQTWPAWQAVFNSQTLHRSPNPQRWRIRCGGSRAQWRRWSGVSSQNF