McDonnell Genome Institute

Washington University

CircRNA

chr12|40980908|40993269|+|CNTN1|ENST00000347616.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9912

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

6

Peptide

IKTDGAGPPGPPGGLRIEDIR

Amino Acids from 5' Exons

ALQALQVVEKTLEPLLWHLLGAVVQTIIVLFLNTLSRPRLFFQMTGKMQRQ,PSRPSRWSENRRHSHFCGTYLEPWFRQSSYFIHYPDQDYSFRLERCKD,PPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKT

Amino Acids from 3' Exons

IPQLLKEIWRQQEQWTSHGWSMNSAWQPIHWVEESPVYHLTELKQTVL,SPNYRKYGGSKSSGLNPMDGVIPRGSNQYTGRRAQYTIQNNRRC,PPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGA