McDonnell Genome Institute

Washington University

CircRNA

chr12|40918638|40930002|+|CNTN1|ENST00000347616.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

87

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

DLDQFLK

Amino Acids from 5' Exons

FLRKTKDLDQFLKSSQSIPFIQRNHWKEKSHSTVGHEPALSRFT,FGRQRIWTNFRAANQYHLSRGITGRKSLTQLGTSQPFPGLQ,SEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARASPFPVY

Amino Acids from 3' Exons

MILAIAGFMNFLYLSQWINGDLCLRQMAISTLQMLRLPTKAIIPALFPVLLLQRACSANSSHSFQYLN,SLSLASKISCIYHNGTAICVSDKWQSLHCKCGFRQRQLFLLCFQSFYYKERVQQIHPTHSNT,DLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPE