McDonnell Genome Institute

Washington University

CircRNA

chr12|40028300|40048210|-|SLC2A13|ENST00000280871.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9455

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

19

Peptide

EVGSGIASMTVPVYIAEVSPPNLR

Amino Acids from 5' Exons

VHVGTCSSSGGYTVFWLSLFAKPSMAYSERTDSEGPNFISDAWPDHGIHQKQHRGGKRGWL,YMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGS,TCWDLQQFRRLYSFLAFSFCLKALDGLFRKDRLRRPVEFYLRCVVTRPLMRNMIASKTTLKRRKKRLAQ

Amino Acids from 3' Exons

ALLLQCQCTLRRSHHPIEADSPLIPSSSQEGSSLQVLLMEPSVISRRMDG,HCFYDSASVHCGGLTTQFKRPISHHYPLHHRRAVLCKCCWSLQLSPEGWME,IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGW