McDonnell Genome Institute

Washington University

CircRNA

chr12|39337095|39368032|-|KIF21A|ENST00000361418.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9046

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

14

Peptide

DLYNEEVLDLFDTTR

Amino Acids from 5' Exons

VRLMKQMKEEQEKARLTESRRNREIAQLKKDQRKRD,FANKKKNKRKPDLSLEETERLLSKRINVKE,SPNETNERRTRESQTDVKKQRDCSVEKGSTKR

Amino Acids from 3' Exons

LYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYTVGVTTRTVNTESE,SIMKRSLTYLIPLVILMQKVKNQIEFMKIQLEEFILWALQHVLIQNQ,LRGPLIYHSYCKKKIKYKNSRFNWRNLYCGRYNTYCEYRIR