McDonnell Genome Institute

Washington University

CircRNA

chr12|32607956|32638795|+|FGD4|ENST00000427716.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9343

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

QDPLVLYMYGAPQK

Amino Acids from 5' Exons

KQKICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPPDSLDWNDAK,NRKSVGALCSITCNLFSGFPGMRCSLRTIGNCLLIPWTGMMLK,TENLWELNFAASHARTCSADSPVDAPGLSKEIASFPGLEC

Amino Acids from 3' Exons

IESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPKQDPLVLYMYGAPQ,LNQQKYLETVWCAAFFSIWRSQNLGRKLGVSPSKTLLCCTCMVPP,ISRSIWKQCGVQLSSVYGEVKTLAESLVCDPQARPSCAVHVWCPP