McDonnell Genome Institute

Washington University

CircRNA

chr12|32581959|32625068|+|FGD4|ENST00000395740.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9115

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

FLSLSNYSDLK

Amino Acids from 5' Exons

LIIKLFEERVCCEPKCSNPRKAWIDNHTSTKTPLPALATEAGKYRDSGCTDLCGQRCNGSTKPDGMGGESCHSLRYFYSSFTLAYAHSEWRKRNCHSSCITHNRQLWKCFQLQDSRHRPSAPPRRKRGRNRNQGTREGKWGKPSGTGAAGPAPDE,SLSNYSDLKKESAVNLNAPRTPGRHGLTTTPQQKLLSQHLPQRQGNDTDKTQGAQTCVANGVMAAQNQMECEEEKAATLSSDTSIQASEPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMK,HYQIIVIRKSLLTMLLEPQEGMDQPHLNKNSSPSTCHRGREMIQIRLRVHRLVWPTVWQHKTRWNVRRRKLPLLAQILLFKLLNPCLIRTMEKEMKLPQLLHHPQQTAVMEMLLTVATGLQAAQCSPKKEGQKQKPRYKRGKMGKALWNWSSWTSTMR

Amino Acids from 3' Exons

ALQETIDAFHQRHETFRNAIAKDNDIHSEVS,PFKKPSMLFIKGMKPSEMQLQRIMTFTQRF,PSRNHRCFSSKANLQKCNCKGHSLRGF