McDonnell Genome Institute

Washington University

CircRNA

chr12|32564136|32576449|+|FGD4|ENST00000395740.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

ALPSAKPR

Amino Acids from 5' Exons

AAVPVQRSLFHLAPQAAQPHWLVRMYLKKRLREMGTGQQNTQLQVQSHK,QQYLSKDRFSSTLLHKQHNHTGWECIRRGSGNKWEQASKTLSCKSKAT,SSTCPKIALVPPCSTSSTTTLVGENVSEEEAQGINGNRPAKHSAASPKPQ,AAVPVQRSLFHLAPQAAQPHWLVRMYLKKRLREMGTGQQNTQLQVQSHK,QQYLSKDRFSSTLLHKQHNHTGWECIRRGSGNKWEQASKTLSCKSKAT,SSTCPKIALVPPCSTSSTTTLVGENVSEEEAQGINGNRPAKHSAASPKPQ

Amino Acids from 3' Exons

CLQSHYTCRIHLRPIYTKPPGIKLYLVQNQGWRKLNLPLLLVSQKKNPVRYQISSVALKEA,ASKAITPAEFTFVQYTPNPQASFTCKTKDGGNTCLCFLCLKRKTQGIRSHQSLRRQ,PPKPLHLQNSPSSNIHQTPRHKALPSAKPRMEEIKPASASCVSKEKPSKVSDLISRFEGG,CLQSHYTCRIHLRPIYTKPPGIKLYLVQNQGWRKLNLPLLLVSQKKNPVRYQISSVALKEA,ASKAITPAEFTFVQYTPNPQASFTCKTKDGGNTCLCFLCLKRKTQGIRSHQSLRRQ,PPKPLHLQNSPSSNIHQTPRHKALPSAKPRMEEIKPASASCVSKEKPSKVSDLISRFEGG