McDonnell Genome Institute

Washington University

CircRNA

chr12|32305696|32306122|+|BICD1|ENST00000281474.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.937

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

QQLMQVEYEGLK

Amino Acids from 5' Exons

VEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPNNDDKMNGHIHGPLVKLNGDYRTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQ,LNTKASMRLSDLRRRRYCTASWKMPSDKRLLSTNWKKPSRLKMKESKRTTCGRSSPSISASMITISASQMDSNLPRMGVNQTMMTKTVISMGLLNMETIGLPPGKESLTLSLTYSVSTFQKYRSSSSLC,IRRLKADAIGGDGTAEQPAGRCHPIERDCAPTGRSPRDFKKKRAKEQPAEGALPVYQPQPYQHLSRWTQICRGWETKQQNERSYPWASCETEWRLSDSHLKERRVSEPCLLIQAEHFRNTEVEAAAYA

Amino Acids from 3' Exons

VEYEGLKHEIKRFEEETVLLNSQLEDAIRLKEIAEHQLEEALETLKNEREQKNNLRKELSQYISLNDNHISISVDGLKFAEDGSEPNNDDKMNGHIHGPLVKLNGDYRTPTLRKGESLNPVSDLFSELNISEIQKLKQQLMQ,LNTKASMRLSDLRRRRYCTASWKMPSDKRLLSTNWKKPSRLKMKESKRTTCGRSSPSISASMITISASQMDSNLPRMGVNQTMMTKTVISMGLLNMETIGLPPGKESLTLSLTYSVSTFQKYRSSSSLC,IRRLKADAIGGDGTAEQPAGRCHPIERDCAPTGRSPRDFKKKRAKEQPAEGALPVYQPQPYQHLSRWTQICRGWETKQQNERSYPWASCETEWRLSDSHLKERRVSEPCLLIQAEHFRNTEVEAAAYA