McDonnell Genome Institute

Washington University

CircRNA

chr12|30716507|30735206|-|CAPRIN2|ENST00000298892.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9973

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

EGPEKGAHAK

Amino Acids from 5' Exons

VFNVNAPLPPRKEQEIKESPYSPGYNQSFTTASTQTPPQCQLPSIHVEQTVHSQET,YLTLMHLCLHEKNKKKNPLIHLATIKVLPQQVHKHHPSANCHLYMNKLSILKRL,IRCTSASTKRTRNKRIPLFTWLQSKFYHSKYTNTTPVPTAIYTCRTNCPFSRD

Amino Acids from 3' Exons

LLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQNLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLTCPERNESL,YKRKRRPREGSTCNLRLRRKSFELYFKFSMYCRTHRSTYKKTSKGVMVQCICLQKNLTTSLSFQNPALKEMKV,TKSAKEGPEKGAHAKTGEEKASNYTSSSVCIAELDTGARTKRLQRGFEWCSVFAFKRTLPHVFKTDLPKKKSE