McDonnell Genome Institute

Washington University

CircRNA

chr12|30636981|30639735|-|IPO8|ENST00000256079.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

12

Peptide

LIWKKMCIPLFVQLVLER

Amino Acids from 5' Exons

ASPEDVYNRTEYPFGIAKSTSCSRCCGGTDCSLNSFPFPWPKAGLCYTTGKPGRSFKSRESYGRK,HHDRKMCIIGLSILLELQNRPPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEEN,IMTGRCVDVSFWNCKIDLLQMLWWDRLFPQFFSFSLASRSVLLDNWTGKIVQKQRKLIWKKM

Amino Acids from 3' Exons

CIPLFVQLVLERLTRGVKTSELRTMCLQVAIAALYYNPDLLLHTLERIQLPHNPGPITVQFINQWMNDTDCFL,AFHSSFNLFWRDLEGSKLVSFVLCVFRLQLLPCTTTLICCYILNEFSCLTTLDLSLYSLINGMIQIVFL,HSTLRSTCFGEINSRGQNASYYVSSGCNCCLVLQPFAATYFRTNSVASQPWTYHCTVYKSMDEYRLFSW