McDonnell Genome Institute

Washington University

CircRNA

chr12|2817222|2818353|+|ITFG2|ENST00000540929.5

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9504

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

VMLISDIGGHAYLCRQPGE

Amino Acids from 5' Exons

LNELVVGDTSGKVSVYKNDDSRPWLTCSCQGM,MNWWWETPAGRCLCIKMMTVGHGSPVPARE,KTGGGRHQREGVCVKQSAMAHLFLPGN

Amino Acids from 3' Exons

NLLVAVSAEGWFHLFDLTPAKVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIGGHAYLCRQPGEESVDTRAYPKGL,TCWWQVLKAGFICLTHLPRCWMLLGTTRHSERSSVQSSSSTSLPTPRSCSATSVGMPTFAGSQESRSQWILEHIPRDW,PVGGSECRLVSFVPDTCQGVGCFWAPRDTNRRGAASSLQAAHPCQHQGHADQRHRWACLPLQAARRVGVSGYSISQGIG