McDonnell Genome Institute

Washington University

CircRNA

chr12|26916001|26928905|-|ASUN|ENST00000261191.11

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9038

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

14

Peptide

ITLMAALAAVGPPNPR

Amino Acids from 5' Exons

VVLFYWNNHESQVLKSLVICLVAMEERFFCTSLAVLDPFKIHLQLVKDVEEELQTTGL,SFCFIGTTTKVRFSHSYAPWRRDFFARPQFSIHSRRSTFNRMWRKSYRLPDY,RSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTDYRIT

Amino Acids from 3' Exons

LMAALAAVGPPNPRADPECCSILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAK,WQHPLLGLLILGQIQSAAVFCMALLQQWKLSAKLLNTNMRLVLYSWRMQNVLEIEDESVLLMQK,NGSISRCWASSSGRSRVLQYSAWPCCSSGNSLQNYIPTGSYSTHGECRTCWKRTNNLYYCKK