McDonnell Genome Institute

Washington University

CircRNA

chr12|26655707|26659285|-|ITPR2|ENST00000381340.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9862

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

LTFEEYIAK

Amino Acids from 5' Exons

IFYNRLFQKYEEEICPDNGICRIFERSCKPALSFWGRKKTDI,YDSITDSSRNDMKRKFALTMEFVEEYLKEVVNQPFPFGDKEKNKLTFE,MILQTLPEMIRGNLPQWNLLKNIKKLTSPFLLGIKKKINHL

Amino Acids from 3' Exons

EYIAKNFCVMQSQIGYDILAEDTITALLHNNRKLLEKHITAKEIETFVSLLRRNREP,NILLRISVSCSPRLAMIFWQKILSQLCCTTTENYRNISQQKKKHLSVYSGEIGSQ,IYCEFLCHAVPDWLYFGRRYYHSFVAQQQKTTRETYHSKRNRNICQFTQEKSGAK