McDonnell Genome Institute

Washington University

CircRNA

chr12|22506710|22523624|-|C2CD5|ENST00000333957.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9282

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

IHNPGELQR

Amino Acids from 5' Exons

EFPFFTLTAFPPGFLVHVGGVVSARSVKLLDRIHNP,NFHFLPRHFLLDSLYTLGVLVHVLSFWIVSTIL,ISIFYLDGISSWIPCTRWGCSCTFCEAFGSYPQS

Amino Acids from 3' Exons

VSCRGRLAKYLKEEMQLWGTYSVSIWRASLGWCEPERRVLWINVAQQHSFLHVIPHPKKR,AAEEDWLESTNERKCSCGVLTVFRSGGRVWVSGASHRNGVYSGIKPSSIPSCMFPIQRNEG,ELQRKIGLKVLEMRGNAVVGYLQCFDLEGESGLVVRAIGTACTLDKLSSPAAFLPACNSPSKEMK