top of page

McDonnell Genome Institute

Washington University

CircRNA

chr12|22055148|22062434|+|CMAS|ENST00000229329.6

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9708

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

MWPNNLVHK

Amino Acids from 5' Exons

CMGFDRPNECGQTIWCTSSSKKFSFKRQLYLTRCHHRISLS,VWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHN,YGFRQTMMKLRMWPNNLVHKFIEEVLKFQKTALPHMPSNFLIIIM

Amino Acids from 3' Exons

VRLISERACSKQTLSSLKLDCKMEVSVSDKLAVVDEWRKEMGLCWKEVAYL,GSQKGPVQSRRCLLNWIAKWKSVYQTSQLMNGEKKWACAGKKWHIL,EANLRKGLFKADAVFFKTGLQNGSQCIRQASSCRMEKRNGPVLERSGIS

bottom of page