McDonnell Genome Institute

Washington University

CircRNA

chr12|20613442|20616384|+|PDE3A|ENST00000359062.3

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9964

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

RVHILESR

Amino Acids from 5' Exons

SSGTSITVDIAVMGEAHGLITDLLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLAIPK,LQEPVLLWTSPSWARPTASLPTSWQTLLFHQTCAHPEPATCSAHSSPSRPFTSPEIPSLRSVKTIPVLTLKRALKKTSLLFQ,FRNQYYCGHRRHGRGPRPHYRPPGRPFSSTKRVHILESREQLAQHTAHLPGHSQAQSESRHFAQKLYLFLRELKRQACYSK

Amino Acids from 3' Exons

RLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSS,AEGVCLLACDEFLPLGPPPPRPQVYPPWSLHQYGETAAPASNCRKHLHP,PEKEFASWLVETSFFHLDHHHLGHRSTHLGACTSTERPQHQHQTAGSTFIQ