McDonnell Genome Institute

Washington University

CircRNA

chr12|14840444|14841153|-|ART4|ENST00000228936.4

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

27

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

GDWLQLR

Amino Acids from 5' Exons

VAIKIDFDFAPGSFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAMASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGDWLQLRSTGNLSTYNCQLLK,LQLKSTSTSHQVLLMISTKAVANRLWRNLKGIISQKTKPRRIILGCGKKPTPGLTKEKFYPRTLPHTLWLFCFIHTAMFILTLLEPWPLLPGLHSSMNVHSTSNIYTTTSPQQSSCGKTASWRMALCAMRCIIGRRMSTLMPTQGPPFDLANSSPHPSKKRHRSLGTRHYLPYSPAWVHLYSTSPSRRKSSLPMSCLKLIATTQEETGCSGQLGTAHITVSCK,CNNRLRLRTRFFSVPRLQTGYGETNSRGLFHKRHRSPEELFDVAKSPLSLAPRKSSTPEHDYHTRCGYFVLYIEQQCSFLYSHGLCCQDSTAVTFIPLQIFTLLPHLSNPAAEERQHHGEWHSVLGALDEGCPLCLHRGHHSIWPIPLHIPPERRGTGVWEPDTIYHIHLPGCTCTVLLPQEGSLDPSLAVSYKYELPPKRRLVAVEVNWEPEHILSAAK

Amino Acids from 3' Exons

VAIKIDFDFAPGSFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWLNQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAMASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYHPRGDWLQLRSTGNLSTYNCQLLK,LQLKSTSTSHQVLLMISTKAVANRLWRNLKGIISQKTKPRRIILGCGKKPTPGLTKEKFYPRTLPHTLWLFCFIHTAMFILTLLEPWPLLPGLHSSMNVHSTSNIYTTTSPQQSSCGKTASWRMALCAMRCIIGRRMSTLMPTQGPPFDLANSSPHPSKKRHRSLGTRHYLPYSPAWVHLYSTSPSRRKSSLPMSCLKLIATTQEETGCSGQLGTAHITVSCK,CNNRLRLRTRFFSVPRLQTGYGETNSRGLFHKRHRSPEELFDVAKSPLSLAPRKSSTPEHDYHTRCGYFVLYIEQQCSFLYSHGLCCQDSTAVTFIPLQIFTLLPHLSNPAAEERQHHGEWHSVLGALDEGCPLCLHRGHHSIWPIPLHIPPERRGTGVWEPDTIYHIHLPGCTCTVLLPQEGSLDPSLAVSYKYELPPKRRLVAVEVNWEPEHILSAAK