McDonnell Genome Institute

Washington University

CircRNA

chr12|14434336|14461133|+|ATF7IP|ENST00000261168.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9984

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

IAEVESNEK

Amino Acids from 5' Exons

QKKVMKRTTNLRKKSKYMKMMKDLLRK,RSRKKGQQTGRRASNTRKTFE,EVESNEKDNKPEEEEQVIHEDDERPSEK

Amino Acids from 3' Exons

YLQPILSLLQQLSVVNLNCRLQLRVPSQQRQFFLHPIQLLLLLLRCLVEIPSLQSLYSLCQFCMYLLQYPPSLSFYRAIQGLWLINHLAMLNSFLCKAHLQVVLPKIQYPCHPCQIPLNQTTFLLCPVLVFKGTLLPVLHHWEQHLLCRLFQQHTLLYKPQGLLYPQWAHQDSIVHQLIEVLYRKFQFLHLVLRLLQNRTAIPPQEL,IFNQSCHSSSSCQSTIADSSDFGFPHSNVSSSCTQYSYCSCYYSGAWKSPAYNLFTAFASDFACTCCSILPASASTEPSRDFGDSTIWQCIHFCAKPTYSEWSYQKSSILAILAKSHTKQRSFCAQSYSKEPYCQCCTIGNNTCCAGCSNSTLYCTSHKDFFTHSGPIRTLSINSRSYTDENSNFCIYFVCCRTEQQYHPKN,SSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTATVVATTQVPSGNPQPTISLQPLPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPNPTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSPSTNRGPIQMKIPISAFSTSSAAEQNSNTTPRI