McDonnell Genome Institute

Washington University

CircRNA

chr12|138266|141285|+|IQSEC3|ENST00000382841.2

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9366

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

GAAAGALALPAAHLR

Amino Acids from 5' Exons

IEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRSPTAESLAAEKALMEGYGLVGLPLVRSPSLPPTFAGTLTELEDSFTEQVQSLAKSIDDALSTWSLKTMCSLRESGAYQLHQALQAAAGPPGLEAEGRAPESAGPGPGDDAAETPGLPPAHSGTLMMAFRDVTVQIANQNISVSSSTALSVANCLGAQTVQAPAEPAAGKAEQGETSGREAPEAPAVGREDASAEDSCAEAAASGAADGATAPKTEEEEEEEETAEVGRGAEAEAGDLEQLSSSSTSTKSAKSGSEASASASKDALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLNLFN,LKCNISTAVTWCPGAPLAPSKPPSANTSSARTSRKSATRFWRAACHGGSPCARCGHPRPRAWRPRKRSWRATASWGCRWCARPPCRPPSQAPSPSWRTPSPSRCNPWPSPSTTRSARGASRPCAPCGRVALTSSTRPCRRPRGPQAWRPRGGRRRARAPGPGMTPRRPPACPRPTAGPSWLSGTSRCRSPTRTYPSPPPRLCRWPTAWALRRSRPPQSPRRARPSRARPLGGRPRKPPPWAGRTRQPRTHAQRLRLVGRRMGPQPPKQRRKRRRRRRRRWGEGPRPRQATWSSAAAARPPSPPSQARRRRPPPPRTPCRPSACRATTARTQPAASRPRSPPTPCASGSTASASTSST,NARTVRRSPGVPARRLHHPNRLPPIPAQQELRENPQLASGEPPATADLPAQGAVTHGREPGGRESAHGGLRPRGAAAGALALPAAHLRRHPHRAGGLLHRAGAIPGQVHRRRAQHVEPQDHVLPAGEWRLPAPPGPAGGRGAPRPGGRGAGAGERGPRARGRRGDPRPAPGPQRDPHDGFPGRHGADRQPEHIRLLLHGSVGGQLPGRSDGPGPRRARGGQGRAGRDLWAGGPGSPRRGPGGRVSRGLMRRGCGWGGGWGHSPQNRGGRGGGGDGGGGERGRGRGRRLGAAEQQQHVHQVRQVRLGGVGLRLQGRPAGHDPEPAALPLREPSQLQVAHALHRHPAQAALPHRPQPLQH

Amino Acids from 3' Exons

KPRQGHPVPDLTRLHPGHPHRCGPFPPPAKGPQPPDDWRVPGQQQEAVQPRRAG,NPDKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVL,TPTRASSSSHAASSRTPPSVWPISSSSERASAARLESSWATARSSSTATCW