McDonnell Genome Institute

Washington University

CircRNA

chr12|132847042|132861634|-|CHFR|ENST00000266880.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9462

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

9

Peptide

GVFLLSGSGGGGISPK

Amino Acids from 5' Exons

NYLATRGLTWKNMLTESLVALQRGVFLLS,ITWQPEVHGKTCPRASWLSSGECFCCL,LPGNQRFDMEKHVDREPRGSPAGSVSAV

Amino Acids from 3' Exons

GLGVVASPLKEVVPLWQVMKSPALPQLSQTERLRPFRRWNPRIRRIWSPRRKEE,VWGWWHLPRKWSLCGKSLQLCLSSPRQKDCVLFVVGTPGSGGFGAREEENER,SGGGGISPKGSGPSVASDEVSSFASALPDRKTASFSSLEPQDQEDLEPVKKKMRG